PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E04034.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB_related
Protein Properties Length: 338aa    MW: 36496.3 Da    PI: 6.423
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E04034.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32e-145296147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +W++eE+ +++da  ++G + Wk+I +++  ++t  q++s+ qky
   Pahal.E04034.1 52 REPWSAEEHGRFLDALLMFGRD-WKKIEEHVR-TKTTIQIRSHAQKY 96
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-1746102IPR009057Homeodomain-like
PROSITE profilePS5129417.53447101IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-749103IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-165099IPR006447Myb domain, plants
SMARTSM007171.1E-85199IPR001005SANT/Myb domain
PfamPF002491.8E-115296IPR001005SANT/Myb domain
CDDcd001676.13E-75497No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MRVCVYIVQG ENLSAWVLGD SIASGPSRGE MERGNEAPGK KARKPYTMTK PREPWSAEEH  60
GRFLDALLMF GRDWKKIEEH VRTKTTIQIR SHAQKYFLKV QKLGLAAGLP PAHPRRRFTM  120
MEQQNSAAGS SAAAVPLLHG EPHSAPVAVP GPSDAVAHGC IGWNSPGDLP ADGSSGCFSS  180
EMRCLDWAGV SASGIPAWLN SDAQSQIAPP ATLPGGSQFI GAPSFGSTSM VWAGSSTSGG  240
SAIDSVQDED EQIELPLSPD DLHFAQVYRF VGDVFDPNTP IPVEAHLQKL KDMDDITVKT  300
ILLVLRNLET NLSALQFEPI RRLLSTYDPR RGLFGQL*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1069696e-66AK106969.1 Oryza sativa Japonica Group cDNA clone:002-119-G02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971681.11e-161PREDICTED: protein REVEILLE 8-like isoform X2
TrEMBLC5XP981e-125C5XP98_SORBI; Putative uncharacterized protein Sb03g005480
STRINGSb03g005480.11e-125(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.12e-49MYB_related family protein